PeppedCo packaging. Lot number printed on every vial.
LL-37
Human cathelicidin peptide
$85.00per 5 mg vial
Size
Stack and save: 5% off 3+ vials, 10% off 6+ vials. Mix and match across the catalog.
Third-party tested lot
Lot-matched COA
Free US shipping $200+
Discreet packaging
For laboratory research use only. Not for human or veterinary use. Not a drug, food, dietary supplement or cosmetic. No dosing, administration or reconstitution guidance is provided.
Specifications
| Catalog no. | PC-LL37-05 |
|---|---|
| CAS number | 154947-66-7 |
| Sequence | [LL-37, 37 aa] Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493.3 g/mol |
| Length | 37 aa |
| Stated content | 5 mg per vial |
| Form | Lyophilized powder, sealed glass vial |
| Purity | Release threshold ≥98.0% (HPLC). Measured result on the lot COA. |
| Testing | Third-party HPLC purity and Mass spectrometry identity, every lot |
| Storage | -20 °C, dry, protected from light |
| Synonyms | CAMP · hCAP18 (134-170) |
Lot and COA
First lot report posts at release
Every vial ships with its lot number printed on the label. The certificate of analysis for that lot is published here and on our Lab Testing page before it ships.
About LL-37
LL-37 is the 37-amino-acid human cathelicidin peptide, cleaved from the hCAP18 precursor protein. It is one of the most widely studied antimicrobial peptides in host-defense and cell-culture research. Supplied as a lyophilized powder for in-vitro laboratory research.
Search the published literature on PubMedStorage and handling
- Long-term: store sealed vials at -20 °C, dry and protected from light.
- On arrival: lyophilized material tolerates ambient transit. Move it to the freezer when received.
- Handling: use appropriate lab PPE and follow your institution's chemical hygiene plan.
Keep exploring